Depositing data to the  database:

A majority of the 2-D structural data available in the database are obtained by weaning through publications. Certainly this approach is not the best and at best it can only lead to incomplete database. Therefore we would like to request researchers to provide us the data during or prior to publications. The data that we would like to receive to include in the database may be grouped into two types. (a) A molecular structure (b) Data related to a molecular structure.

(a) Molecular Structure: Molecular structural data are accepted in MDL format as shown below. Multiple structures are provided in a single file by appending MDL files using $$$$ as a demarcation symbol. The AIDS number used in the MDL (a) and Excel spreadsheet (b) may be arbitrarily assigned, but these numbers need to maintain correspondence between (a) and (b). The data may be sent to us by e-mail -  bhat@nist.gov

Example of a MDL file:


  -ISIS-  01290710382D

 36 39  0  0  0  0  0  0  0  0999 V2000
   -1.3250    1.0458    0.0000 N   0  0  3  0  0  0  0  0  0  0  0  0
    2.9542   -1.4292    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -4.8958   -0.2000    0.0000 S   0  0  3  0  0  0  0  0  0  0  0  0
    3.6625   -1.0250    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    0.1042    0.2208    0.0000 N   0  0  3  0  0  0  0  0  0  0  0  0
    2.2292   -1.0167    0.0000 N   0  0  3  0  0  0  0  0  0  0  0  0
    0.8125   -0.1917    0.0000 C   0  0  3  0  0  0  0  0  0  0  0  0
   -0.6083    1.4708    0.0000 C   0  0  2  0  0  0  0  0  0  0  0  0
   -2.0458    1.4500    0.0000 C   0  0  2  0  0  0  0  0  0  0  0  0
    0.1042    1.0458    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -1.3250    0.2208    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -4.1833    0.2083    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    1.5167    0.2250    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    0.8125   -1.0167    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -0.6083   -0.1917    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -4.4875   -0.9042    0.0000 O   0  0  0  0  0  0  0  0  0  0  0  0
   -5.3125    0.5208    0.0000 O   0  0  0  0  0  0  0  0  0  0  0  0
    4.3792   -1.4417    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -2.7625    1.0333    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    2.2292   -0.1917    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    1.5125   -1.4250    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    2.9542   -2.2542    0.0000 O   0  0  0  0  0  0  0  0  0  0  0  0
    3.6625   -0.1917    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -3.4750   -0.2000    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -4.1833    1.0333    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -2.7625    0.2083    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -3.4833    1.4458    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -5.6125   -0.6000    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    4.3667   -2.3042    0.0000 O   0  0  0  0  0  0  0  0  0  0  0  0
    0.8042    0.6333    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -0.6208    2.3000    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
   -2.0458    2.2708    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    5.0917   -0.2000    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    5.0917   -1.0292    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    4.3792    0.2125    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
    2.9875    0.3458    0.0000 C   0  0  0  0  0  0  0  0  0  0  0  0
  2  6  1  0  0  0  0
  3 12  1  0  0  0  0
  4  2  1  0  0  0  0
  5 15  1  0  0  0  0
  6 21  1  0  0  0  0
  7  5  1  0  0  0  0
  8  1  1  0  0  0  0
  9  1  1  0  0  0  0
 10  8  1  0  0  0  0
 11  1  1  0  0  0  0
 12 25  2  0  0  0  0
 13  7  1  0  0  0  0
 14  7  1  0  0  0  0
 15 11  1  0  0  0  0
 16  3  2  0  0  0  0
 17  3  2  0  0  0  0
 18  4  2  0  0  0  0
 19  9  1  0  0  0  0
 20 13  1  0  0  0  0
 21 14  1  0  0  0  0
 22  2  2  0  0  0  0
 23  4  1  0  0  0  0
 24 26  2  0  0  0  0
 25 27  1  0  0  0  0
 26 19  1  0  0  0  0
 27 19  2  0  0  0  0
 28  3  1  0  0  0  0
 29 18  1  0  0  0  0
 30  7  1  0  0  0  0
  8 31  1  1  0  0  0
  9 32  1  6  0  0  0
 33 35  1  0  0  0  0
 34 18  1  0  0  0  0
 35 23  2  0  0  0  0
 36 23  1  0  0  0  0
 10  5  1  0  0  0  0
 12 24  1  0  0  0  0
  6 20  1  0  0  0  0
 33 34  2  0  0  0  0
M  END
>  <CDBREGNO> (7)
7

>  <aids_no> (7)
007982

$$$$

MDL data records for a second structure

 

$$$$

 

You may assign a serial numbers as aids_no for structures.

 

(b) Data related to a molecular structure.

Data related to a molecular structure is provided in an Excel spreadsheet of the following type. TEXT is some description of the compound if available. CHEM NAME is the IUPAC Name. ALT NAME are other names of the compound when available. Multiple names are separated by ; as shown below. Class is the class or classes of the compound as illustrated below. This class may be used by the database to classify compounds for navigation purposes.

AIDS-NO TEXT CHEM NAME ALT NAME CLASS COMPANY Anti-HIV Enzymatic Data Ref (eg Pubmed ID) for Anti-HIV Enzymatic data Anti-HIV Cellular data Ref (eg PubMed ID) for Anti-HIV Cellular data Submitting Author/Authors
006301   Benzenamine, 2-[[4-[(3S)-4-[(1S)-1-[4-(1,3-benzodioxol-5-ylsulfonyl)phenyl]ethyl]-3-methyl-1-piperazinyl]-1-piperidinyl]carbonyl]-3-methyl-   PIPERAZINES; CCR5 CO-RECEPTOR INHIBITORS SCHERING-PLOUGH        
006302   Benzenamine, 2-[[4-[(3S)-4-[(1S)-1-[4-(1,3-benzodioxol-5-ylsulfonyl)phenyl]ethyl]-3-methyl-1-piperazinyl]-1-piperidinyl]carbonyl]-3-chloro-   PIPERAZINES; CCR5 CO-RECEPTOR INHIBITORS SCHERING-PLOUGH        
007800   Piperazine, 1-[(1S)-1-[4-(1,3-benzodioxol-5-ylmethyl)phenyl]ethyl]-4-[1-(2,6-dimethylbenzoyl)-4-piperidinyl]-2-methyl-, (2S)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
007801   Piperazine, 1-[(1S)-1-[4-(1,3-benzodioxol-5-ylsulfonyl)phenyl]ethyl]-4-[1-(2,6-dimethylbenzoyl)-4-piperidinyl]-2-methyl-, (2S)-   PIPERAZINES; CCR5 CO-RECEPTOR INHIBITORS SCHERING-PLOUGH        
007877   1-[(2,4-Dimethyl-3-pyridinyl)carbonyl]-4-methyl-4-[3(S)-methyl-4-[1(S)-[4-(trifluoromethyl)phenyl]ethyl]-1-piperazinyl]-piperidine, N1-Oxide Sch-350634; SCH 350634 CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
007926   Benzenamine, 3-chloro-2-[[4-[(3S)-4-[(1S)-1-(4-iodophenyl)ethyl]-3-methyl-1-piperazinyl]-4-methyl-1-piperidinyl]carbonyl]-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
007982   Phenol, 3-methyl-2-[[4-methyl-4-[(3S)-3-methyl-4-[(1S)-1-[4-(methylsulfonyl)phenyl]ethyl]-1-piperazinyl]-1-piperidinyl]carbonyl]-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
008283   (2S)-Piperazine, 4-[1-(2,6-dimethylbenzoyl)-4-methyl-4-piperidinyl]-1-[(1S)-1-(4-iodophenyl)ethyl]-2-methyl-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
008290   Piperazine, 4-[1-(2,6-dimethylbenzoyl)-4-methyl-4-piperidinyl]-2-methyl-1-[(1S)-1-[4-(trifluoromethyl)phenyl]ethyl]-, (2S)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES; PIPERAZINES SCHERING-PLOUGH        
008372 SUPER-ATOM STRUCTURE N.alpha.-Nonanoyl-RANTES (residues 2-68) NNY-RANTES CCR5 CO-RECEPTOR INHIBITORS; RANTES ANALOGS; CHEMOKINES; PROTEINS GRYPHON SCIENCES        
010845 DIHYDROCHLORIDE SALT; HYDRATE (0.3) 1-[(2,4-Dimethyl-3-pyridinyl)carbonyl]-4-methyl-4-[3(S)-methyl-4-[1(S)-[4-(trifluoromethyl)phenyl]ethyl]-1-piperazinyl]-piperidine   CCR5 CO-RECEPTOR INHIBITORS; PIPERAZINES SCHERING-PLOUGH        
011188   Methanone, (4-bromophenyl)[1'-(2,6-dimethylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
011428 RESIDUES 1-70; SEQUENCE FROM GENBANK, ACCESSION NUMBER B35673 APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA; Macrophage Inflammatory Protein -1.alpha. LD78-.beta. isoform (Human) LD78-.beta. isoform; MIP-1.alpha. LD78-.beta. Isoform CHEMOKINES; CCR5 CO-RECEPTOR INHIBITORS; PROTEINS; PEPTIDES, DISULFIDE          
013063   Methanone, (4-bromophenyl)[1'-[(2,4-dimethyl-1-oxido-3-pyridinyl)carbonyl]-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-methyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013064   Methanone, (4-bromophenyl)[1'-[(2,4-dimethyl-3-pyridinyl)carbonyl]-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-methyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013075   [1,4'-Bipiperidin]-4-amine, N-(4-bromophenyl)-1'-(2,6-dimethylbenzoyl)-4'-methyl-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013111   Methanone, [1'-(2-amino-6-chlorobenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl](4-bromophenyl)-, O-methyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013131   Methanone, (4-bromophenyl)[1'-(2,6-dimethylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-ethyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013132 E-ISOMER Methanone, (4-bromophenyl)[1'-(2,6-dimethylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-ethyloxime, (E)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013133   Methanone, (4-bromophenyl)[1'-(2,6-dimethylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-methyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013138 E-ISOMER Methanone, (4-bromophenyl)[1'-(2,6-dimethylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-methyloxime, (E)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013139 MIXTURE OF E/Z ISOMERS Methanone, (4-bromophenyl)[1'-(2,6-dimethylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-methyloxime, (E/Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013152   1,4'-Bipiperidine, 4-[(4-bromophenyl)methyl]-1'-(2,6-dimethylbenzoyl)-4'-methyl-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013367   Methanone, (4-bromophenyl)[1'-(2-hydroxy-6-methylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-methyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
013368   Methanone, [1'-(2-amino-6-methylbenzoyl)-4'-methyl[1,4'-bipiperidin]-4-yl](4-bromophenyl)-, O-methyloxime, (Z)-   CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES SCHERING-PLOUGH        
021039 TARTARATE SALT; Z-ISOMER; MIXTURE OF FOUR ROTAMERS Methanone, (4-bromophenyl)[1'-[(2,4-dimethyl-3-pyridinyl)carbonyl]-4'-methyl[1,4'-bipiperidin]-4-yl]-, O-ethyloxime, (Z)-, N1-oxide SCH-C; SCH 351125; SCH C; AK671/SCH-C; SC-351125 CCR5 CO-RECEPTOR INHIBITORS; PIPERIDINES; HIV ENTRY INHIBITORS SCHERING-PLOUGH